PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009780114.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRAS
Protein Properties Length: 822aa    MW: 89923.6 Da    PI: 6.3024
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009780114.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS413.71.7e-1264448032374
            GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshl 96 
                      +lLl+cAeavs+++le+a+++L ++sel++p g++ qR+aayf eA++arl++s+ ++y+alp ++ +   +++ ++a+++f+ +sP++kfsh+
  XP_009780114.1 444 LTLLLQCAEAVSADNLEEANKMLLEVSELSTPFGTSAQRVAAYFSEAISARLLNSCLGIYAALPITNVPVLYTQKMASAFQVFNGISPFIKFSHF 538
                     579******************************************************************999*********************** PP

            GRAS  97 taNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledlel 191
                     taNqaI ea+e+e+rvHiiD+di+qGlQWp L++ LasRp+gpp +R+Tg+g+    s ++le+tg+rL++fAe+lg+pfef + va+++ +l++
  XP_009780114.1 539 TANQAIQEAFEREDRVHIIDLDIMQGLQWPGLFHILASRPGGPPFVRLTGLGN----SMDALEATGKRLSDFAERLGLPFEFLP-VADKVGNLDP 628
                     *****************************************************....***************************.7********* PP

            GRAS 192 eeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvE 286
                     e+L+v+++Ea+aV++    h+l+d ++s ++    +L+l+++l Pkvv+vveq+++h ++sFl rf+ea++yysalfdsl a +++eseer++vE
  XP_009780114.1 629 EKLNVSKREAVAVHWLQ--HSLYDVTGSDSN----TLSLLQRLAPKVVTVVEQDLSH-AGSFLGRFVEAIHYYSALFDSLGACYGEESEERHVVE 716
                     ****************9..999999999999....**********************.899********************************** PP

            GRAS 287 rellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                     ++ll++ei+nv+a  g +r  + + +++Wre+l+++GF++++l  +aa+qa lll +++s+gy++ e++g+l lgWkd  L+++SaWr
  XP_009780114.1 717 QQLLSKEIRNVLAVGGPSRSGEVK-FNNWREKLQQSGFRSISLAGNAAAQATLLLGMFPSHGYTLVEDNGTLKLGWKDLCLFTASAWR 803
                     ******************888776.**************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098561.575417783IPR005202Transcription factor GRAS
PfamPF035145.9E-124444803IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008356Biological Processasymmetric cell division
GO:0009630Biological Processgravitropism
GO:0009956Biological Processradial pattern formation
GO:0048366Biological Processleaf development
GO:0051457Biological Processmaintenance of protein location in nucleus
GO:0090610Biological Processbundle sheath cell fate specification
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 822 aa     Download sequence    Send to blast
MAKAFPLDCN NCGNTSANVG GSSTYHCKDI NNLQPSPSCE LGNNSKMVRK RAASDMEIQT  60
GAGEENRYLR RPVTIGGSHS QLGDLSACGT SNLRHVSNYS TMQMLPSSTN VCGVTSKGAD  120
FTGFSNSIPN LTNYTDAITS SHHIQQQNLN NNNNQSPSVC VFSGLPLFPP DRNRQNGSVQ  180
LQQQPATAPA AAAAIRFESM EESATSATSW IDGIIKDLIN SSAQVSVPQL IQNVREIIHP  240
CNPYLASLLE YRLRSLTSNN NTNNNSGVSA DVHNDAAVAM EFWRRKEGVL PQLASLQQGQ  300
NMNPNSLQPH NILSLPDSSN NHYLNWDIAA PVAPSLNQHQ QISSNNNPTV TADLSFVTSP  360
PILPPQLQQQ QQQQQESSHS QQQAAVDLEQ QKQQQSSSTS LSPTSATDSG KTKTTTPVVP  420
VNTYREKKEE ERQQKMDEDG LHLLTLLLQC AEAVSADNLE EANKMLLEVS ELSTPFGTSA  480
QRVAAYFSEA ISARLLNSCL GIYAALPITN VPVLYTQKMA SAFQVFNGIS PFIKFSHFTA  540
NQAIQEAFER EDRVHIIDLD IMQGLQWPGL FHILASRPGG PPFVRLTGLG NSMDALEATG  600
KRLSDFAERL GLPFEFLPVA DKVGNLDPEK LNVSKREAVA VHWLQHSLYD VTGSDSNTLS  660
LLQRLAPKVV TVVEQDLSHA GSFLGRFVEA IHYYSALFDS LGACYGEESE ERHVVEQQLL  720
SKEIRNVLAV GGPSRSGEVK FNNWREKLQQ SGFRSISLAG NAAAQATLLL GMFPSHGYTL  780
VEDNGTLKLG WKDLCLFTAS AWRPNSFHTS PALRHFSRPH MD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-494438034375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009780114.10.0PREDICTED: protein SCARECROW-like
SwissprotQ2Z2E90.0SCR_IPONI; Protein SCARECROW
TrEMBLK4D1R00.0K4D1R0_SOLLC; Uncharacterized protein
STRINGSolyc10g074680.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA82582430
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54220.10.0GRAS family protein